PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009609608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 727aa    MW: 80071.6 Da    PI: 5.9795
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009609608.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.3e-2059114156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p+ ++r++L k+lgL+  q+k+WFqN+R+++k
  XP_009609608.1  59 KKQYHRHTQHQIQELEAFFKECPHPDDKQRKDLGKRLGLEPLQIKFWFQNKRTQMK 114
                     688999***********************************************998 PP

2START220.26.5e-692464671206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+++a+ +ep+W +ss    e++ ++e+ ++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW+  +a    ka+tl
  XP_009609608.1 246 ELAVAAMEELIRLAETREPLWIQSSensaEILSEEEYARTFPRGVGpkslgLKSEASRESAVVIMNHINLVEILMDVN-QWTSFFAglvsKATTL 339
                     57899********************99999***********99777********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+ +g+w++vdvS+d+ ++ +    v R++++pSg+li++++ng+sk+tw+ehv
  XP_009609608.1 340 EVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHADGTWAVVDVSLDNLRPTS---VVSRCRRRPSGCLIQELPNGYSKITWIEHV 431
                     ***********************************************************966...5***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  XP_009609608.1 432 EVDDRAVHSIYRPLVNSGLAFGAKRWVATLDRQCER 467
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.47E-1845115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2047117IPR009057Homeodomain-like
PROSITE profilePS5007116.27756116IPR001356Homeobox domain
SMARTSM003897.1E-1858120IPR001356Homeobox domain
PfamPF000461.5E-1759114IPR001356Homeobox domain
CDDcd000861.25E-1759117No hitNo description
PROSITE profilePS5084847.734237470IPR002913START domain
SuperFamilySSF559614.81E-39237469No hitNo description
CDDcd088758.16E-130241466No hitNo description
SMARTSM002341.2E-69246467IPR002913START domain
PfamPF018523.4E-58247467IPR002913START domain
Gene3DG3DSA:3.30.530.203.0E-7315467IPR023393START-like domain
SuperFamilySSF559611.99E-24485719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MFQQNMFDSH NFLLDLSHKT SENEMDLIRD DEFESKSGAD TTELAPSGDD QDPNKRPKKK  60
QYHRHTQHQI QELEAFFKEC PHPDDKQRKD LGKRLGLEPL QIKFWFQNKR TQMKAHHERH  120
ENTQLRNENE KLRAENIRYK EALSTATCPN CGGPAAIGEM SFDEQHLRIE NARLREEIDR  180
ISGIAAKYVG KPMLNYPQLP SPIPPTRSLD LGVASFGHQL GEMYNAGDLL RSISGPTDAD  240
KPMIIELAVA AMEELIRLAE TREPLWIQSS ENSAEILSEE EYARTFPRGV GPKSLGLKSE  300
ASRESAVVIM NHINLVEILM DVNQWTSFFA GLVSKATTLE VLSTGVAGNY NGALQVMTAE  360
FQVPSPLVPT RENYFVRYCK QHADGTWAVV DVSLDNLRPT SVVSRCRRRP SGCLIQELPN  420
GYSKITWIEH VEVDDRAVHS IYRPLVNSGL AFGAKRWVAT LDRQCERLAS VMANNIPTGD  480
VITSPEGRKS MLKLAERMVM SFCAGVGAST AHTWTTLSGS GADDVRVMTR KSIDDPGRPP  540
GIVLSAATSF WLPVPTKRVF DFLRNENSRN EWDILSNGGL VQEMAHIANG RDSGNSVSLL  600
RVNSGNSSQN NMLILQESCT DSTGSYVIYA PVDIAAMNVV LSGGDPDYVA LLPSGFAILP  660
DGSATTNGVG INLETNSAGG SLLTVAFQIL VDSVPTAKLS LGSVATVNSL IKCTVERIKA  720
SIVCESA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609606.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like isoform X1
RefseqXP_016458396.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like isoform X1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLK4CX660.0K4CX66_SOLLC; Uncharacterized protein
STRINGSolyc10g005330.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein